No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023022-A01 |
Product name: | KIAA0992 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant KIAA0992. |
Gene id: | 23022 |
Gene name: | PALLD |
Gene alias: | CGI-151|FLJ22190|FLJ38193|FLJ39139|KIAA0992|PNCA1|SIH002 |
Gene description: | palladin, cytoskeletal associated protein |
Genbank accession: | NM_016081 |
Immunogen: | KIAA0992 (NP_057165, 775 a.a. ~ 839 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTT |
Protein accession: | NP_057165 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (33.26 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |