| Brand: | Abnova |
| Reference: | H00022954-M09 |
| Product name: | TRIM32 monoclonal antibody (M09), clone 2E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM32. |
| Clone: | 2E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 22954 |
| Gene name: | TRIM32 |
| Gene alias: | BBS11|HT2A|LGMD2H|TATIP |
| Gene description: | tripartite motif-containing 32 |
| Genbank accession: | NM_012210 |
| Immunogen: | TRIM32 (NP_036342, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRK |
| Protein accession: | NP_036342 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of TRIM32 over-expressed 293 cell line, cotransfected with TRIM32 Validated Chimera RNAi ( Cat # H00022954-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM32 monoclonal antibody (M09), clone 2E5 (Cat # H00022954-M09 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | TRIM32 modulates pluripotency entry and exit by directly regulating Oct4 stability.Bahnassawy L, Perumal TM, Gonzalez-Cano L, Hillje AL, Taher L, Makalowski W, Suzuki Y, Fuellen G, Sol AD, Schwamborn JC. Sci Rep. 2015 Aug 26;5:13456. |