Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LTB4DH polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about LTB4DH polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00022949-A01 |
| Product name: | LTB4DH polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LTB4DH. |
| Gene id: | 22949 |
| Gene name: | PTGR1 |
| Gene alias: | LTB4DH|MGC34943|ZADH3 |
| Gene description: | prostaglandin reductase 1 |
| Genbank accession: | NM_012212 |
| Immunogen: | LTB4DH (NP_036344, 230 a.a. ~ 328 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVK |
| Protein accession: | NP_036344 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LTB4DH polyclonal antibody (A01), Lot # 051212JC01 Western Blot analysis of LTB4DH expression in 293 ( Cat # L026V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Upregulation of Human Prostaglandin Reductase 1 (PTGR1) Improves Efficacy of Hydroxymethylacylfulvene, an Anti-tumor Chemotherapeutic Agent.Yu X, Erzinger MM, Pietsch KE, Cervoni-Curet FN, Whang J, Niederhuber J, Sturla SJ. J Pharmacol Exp Ther. 2012 Aug 15. |