No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00022943-M12 |
Product name: | DKK1 monoclonal antibody (M12), clone 3C3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant DKK1. |
Clone: | 3C3 |
Isotype: | IgG2b Kappa |
Gene id: | 22943 |
Gene name: | DKK1 |
Gene alias: | DKK-1|SK |
Gene description: | dickkopf homolog 1 (Xenopus laevis) |
Genbank accession: | BC001539 |
Immunogen: | DKK1 (AAH01539.1, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MMALGAAGATRVSVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTTGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKGGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
Protein accession: | AAH01539.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | DKK1 monoclonal antibody (M12), clone 3C3. Western Blot analysis of DKK1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |