Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SIRT2 monoclonal antibody (M01), clone 4B11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about SIRT2 monoclonal antibody (M01), clone 4B11
| Brand: | Abnova |
| Reference: | H00022933-M01 |
| Product name: | SIRT2 monoclonal antibody (M01), clone 4B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SIRT2. |
| Clone: | 4B11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 22933 |
| Gene name: | SIRT2 |
| Gene alias: | SIR2|SIR2L|SIR2L2 |
| Gene description: | sirtuin (silent mating type information regulation 2 homolog) 2 (S. cerevisiae) |
| Genbank accession: | BC003012 |
| Immunogen: | SIRT2 (AAH03012, 128 a.a. ~ 227 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSL |
| Protein accession: | AAH03012 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of SIRT2 over-expressed 293 cell line, cotransfected with SIRT2 Validated Chimera RNAi ( Cat # H00022933-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SIRT2 monoclonal antibody (M01), clone 4B11 (Cat # H00022933-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |