| Brand: | Abnova |
| Reference: | H00022924-M08 |
| Product name: | MAPRE3 monoclonal antibody (M08), clone 3D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPRE3. |
| Clone: | 3D7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 22924 |
| Gene name: | MAPRE3 |
| Gene alias: | EB3|EBF3|EBF3-S|RP3 |
| Gene description: | microtubule-associated protein, RP/EB family, member 3 |
| Genbank accession: | NM_012326 |
| Immunogen: | MAPRE3 (NP_036458.2, 125 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDG |
| Protein accession: | NP_036458.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MAPRE3 is 0.3 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |