Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAPRE1 monoclonal antibody (M02), clone 4F3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about MAPRE1 monoclonal antibody (M02), clone 4F3
| Brand: | Abnova |
| Reference: | H00022919-M02 |
| Product name: | MAPRE1 monoclonal antibody (M02), clone 4F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPRE1. |
| Clone: | 4F3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 22919 |
| Gene name: | MAPRE1 |
| Gene alias: | EB1|MGC117374|MGC129946 |
| Gene description: | microtubule-associated protein, RP/EB family, member 1 |
| Genbank accession: | NM_012325 |
| Immunogen: | MAPRE1 (NP_036457, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQW |
| Protein accession: | NP_036457 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MAPRE1 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Proteomic analysis of the effects of the immunomodulatory mycotoxin deoxynivalenol.da Costa AN, Mijal RS, Keen JN, Findlay JB, Wild CP. Proteomics. 2011 Mar 9. doi: 10.1002/pmic.201000580. [Epub ahead of print] |