Cart 9 Product Products 3 046,85 € (empty)
No products
To be determined Shipping
3 046,85 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 9 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 046,85 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 046,85 €
Data sheet of NCBP2 monoclonal antibody (M02), clone 3A12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about NCBP2 monoclonal antibody (M02), clone 3A12
| Brand: | Abnova |
| Reference: | H00022916-M02 |
| Product name: | NCBP2 monoclonal antibody (M02), clone 3A12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NCBP2. |
| Clone: | 3A12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 22916 |
| Gene name: | NCBP2 |
| Gene alias: | CBC2|CBP20|NIP1|PIG55 |
| Gene description: | nuclear cap binding protein subunit 2, 20kDa |
| Genbank accession: | NM_007362 |
| Immunogen: | NCBP2 (NP_031388, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMR |
| Protein accession: | NP_031388 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged NCBP2 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |