Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KIAA1008 monoclonal antibody (M01), clone 2C7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about KIAA1008 monoclonal antibody (M01), clone 2C7
| Brand: | Abnova |
| Reference: | H00022894-M01 |
| Product name: | KIAA1008 monoclonal antibody (M01), clone 2C7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KIAA1008. |
| Clone: | 2C7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 22894 |
| Gene name: | DIS3 |
| Gene alias: | DKFZp667L1817|EXOSC11|FLJ10484|KIAA1008|MGC33035|RP11-342J4.3|RRP44|bA555G22.1|dis3p |
| Gene description: | DIS3 mitotic control homolog (S. cerevisiae) |
| Genbank accession: | NM_014953 |
| Immunogen: | KIAA1008 (NP_055768, 861 a.a. ~ 956 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKL |
| Protein accession: | NP_055768 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DIS3 is 0.1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |