View larger

KIAA1008 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of KIAA1008 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00022894-A01
Product name:	KIAA1008 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant KIAA1008.
Gene id:	22894
Gene name:	DIS3
Gene alias:	DKFZp667L1817\|EXOSC11\|FLJ10484\|KIAA1008\|MGC33035\|RP11-342J4.3\|RRP44\|bA555G22.1\|dis3p
Gene description:	DIS3 mitotic control homolog (S. cerevisiae)
Genbank accession:	NM_014953
Immunogen:	KIAA1008 (NP_055768, 861 a.a. ~ 956 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	VVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKL
Protein accession:	NP_055768
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.67 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Global analysis of the nuclear processing of transcripts with unspliced U12-type introns by the exosome.Niemela EH, Oghabian A, Staals RH, Greco D, Pruijn GJ, Frilander MJ Nucleic Acids Res. 2014 Jul 1;42(11):7358-69. doi: 10.1093/nar/gku391. Epub 2014 May 21.