| Brand: | Abnova |
| Reference: | H00022894-A01 |
| Product name: | KIAA1008 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant KIAA1008. |
| Gene id: | 22894 |
| Gene name: | DIS3 |
| Gene alias: | DKFZp667L1817|EXOSC11|FLJ10484|KIAA1008|MGC33035|RP11-342J4.3|RRP44|bA555G22.1|dis3p |
| Gene description: | DIS3 mitotic control homolog (S. cerevisiae) |
| Genbank accession: | NM_014953 |
| Immunogen: | KIAA1008 (NP_055768, 861 a.a. ~ 956 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKL |
| Protein accession: | NP_055768 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Global analysis of the nuclear processing of transcripts with unspliced U12-type introns by the exosome.Niemela EH, Oghabian A, Staals RH, Greco D, Pruijn GJ, Frilander MJ Nucleic Acids Res. 2014 Jul 1;42(11):7358-69. doi: 10.1093/nar/gku391. Epub 2014 May 21. |