No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00022874-M03 |
| Product name: | PLEKHA6 monoclonal antibody (M03), clone 1A4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PLEKHA6. |
| Clone: | 1A4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 22874 |
| Gene name: | PLEKHA6 |
| Gene alias: | KIAA0969|MGC176733|PEPP3 |
| Gene description: | pleckstrin homology domain containing, family A member 6 |
| Genbank accession: | BC010522 |
| Immunogen: | PLEKHA6 (AAH10522.1, 1 a.a. ~ 30 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MHPRWAARLPLFISLLERADSVTAAYAKQH |
| Protein accession: | AAH10522.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (29.04 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged PLEKHA6 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |