| Brand: | Abnova |
| Reference: | H00022868-M03 |
| Product name: | KIAA0971 monoclonal antibody (M03), clone 1B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KIAA0971. |
| Clone: | 1B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 22868 |
| Gene name: | FASTKD2 |
| Gene alias: | KIAA0971 |
| Gene description: | FAST kinase domains 2 |
| Genbank accession: | NM_014929 |
| Immunogen: | KIAA0971 (NP_055744, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLTTLKPFGSVSVESKMNNKAGSFFWNLRQFSTLVSTSRTMRLCCLGLCKPKIVHSNWNILNNFHNRMQSTDIIRYLFQDAFIFKSDVGFQTKGISTLTA |
| Protein accession: | NP_055744 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |