Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ICK polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about ICK polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00022858-A01 |
| Product name: | ICK polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant ICK. |
| Gene id: | 22858 |
| Gene name: | ICK |
| Gene alias: | KIAA0936|LCK2|MGC46090|MRK |
| Gene description: | intestinal cell (MAK-like) kinase |
| Genbank accession: | BC035807 |
| Immunogen: | ICK (AAH35807, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQVFFHFLVITFISNSE |
| Protein accession: | AAH35807 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (58.23 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | ICK polyclonal antibody (A01), Lot # 051103JC01 Western Blot analysis of ICK expression in Y-79 ( Cat # L042V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A Novel Protein Kinase from the Ciliate Euplotes raikovi with Close Structural Identity to the Mammalian Intestinal and Male-Germ Cell Kinases: Characterization and Functional Implications in the Autocrine Pheromone Signaling Loop.Vallesi A, Di Pretoro B, Ballarini P, Apone F, Luporini P. Protist. 2010 Jan 12. [Epub ahead of print] |