No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00022853-M02 |
Product name: | LMTK2 monoclonal antibody (M02), clone 3G1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LMTK2. |
Clone: | 3G1 |
Isotype: | IgG2b Kappa |
Gene id: | 22853 |
Gene name: | LMTK2 |
Gene alias: | AATYK2|BREK|KIAA1079|KPI-2|KPI2|LMR2|cprk |
Gene description: | lemur tyrosine kinase 2 |
Genbank accession: | NM_014916 |
Immunogen: | LMTK2 (NP_055731, 1181 a.a. ~ 1280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EPAQTGVPQQVHPTEDEASSPWSVLNAELSSGDDFETQDDRPCTLASTGTNTNELLAYTNSALDKSLSSHSEGPKLKEPDIEGKYLGKLGVSGMLDLSED |
Protein accession: | NP_055731 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to LMTK2 on formalin-fixed paraffin-embedded human ovarian cancer. [antibody concentration 0.7 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |