| Brand: | Abnova |
| Reference: | H00022821-M01 |
| Product name: | RASA3 monoclonal antibody (M01), clone 1F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RASA3. |
| Clone: | 1F11 |
| Isotype: | IgG2a kappa |
| Gene id: | 22821 |
| Gene name: | RASA3 |
| Gene alias: | GAP1IP4BP|GAPIII|MGC46517|MGC47588 |
| Gene description: | RAS p21 protein activator 3 |
| Genbank accession: | BC047242 |
| Immunogen: | RASA3 (AAH47242, 725 a.a. ~ 834 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI |
| Protein accession: | AAH47242 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged RASA3 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |