Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RRAS2 monoclonal antibody (M01A), clone 2D3-4B8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re,WB-Tr |
More info about RRAS2 monoclonal antibody (M01A), clone 2D3-4B8
| Brand: | Abnova |
| Reference: | H00022800-M01A |
| Product name: | RRAS2 monoclonal antibody (M01A), clone 2D3-4B8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant RRAS2. |
| Clone: | 2D3-4B8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 22800 |
| Gene name: | RRAS2 |
| Gene alias: | TC21 |
| Gene description: | related RAS viral (r-ras) oncogene homolog 2 |
| Genbank accession: | BC013106 |
| Immunogen: | RRAS2 (AAH13106, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF |
| Protein accession: | AAH13106 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (48.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | RRAS2 monoclonal antibody (M01A), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |