| Brand: | Abnova |
| Reference: | H00022800-M01 |
| Product name: | RRAS2 monoclonal antibody (M01), clone 2D3-4B8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant RRAS2. |
| Clone: | 2D3-4B8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 22800 |
| Gene name: | RRAS2 |
| Gene alias: | TC21 |
| Gene description: | related RAS viral (r-ras) oncogene homolog 2 |
| Genbank accession: | BC013106 |
| Immunogen: | RRAS2 (AAH13106, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF |
| Protein accession: | AAH13106 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (48.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RRAS2 on formalin-fixed paraffin-embedded human dysgerminoma tissue. [antibody concentration 5 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | In Vivo Regulation of TGF-β by R-Ras2 Revealed through Loss of the RasGAP Protein NF1.Patmore DM, Welch S, Fulkerson PC, Wu J, Choi K, Eaves D, Kordich JJ, Collins MH, Cripe TP, Ratner N. Cancer Res. 2012 Oct 15;72(20):5317-27. doi: 10.1158/0008- 5472.CAN-12-1972. Epub 2012 Aug 23. |