| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00022797-M08 |
| Product name: | TFEC monoclonal antibody (M08), clone 4F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TFEC. |
| Clone: | 4F11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 22797 |
| Gene name: | TFEC |
| Gene alias: | TCFEC|TFECL|bHLHe34 |
| Gene description: | transcription factor EC |
| Genbank accession: | NM_001018058 |
| Immunogen: | TFEC (NP_001018068.1, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWHLSGSILDVYSGEQGISPINMGLTSASCPS |
| Protein accession: | NP_001018068.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of TFEC expression in transfected 293T cell line by TFEC monoclonal antibody (M08), clone 4F11. Lane 1: TFEC transfected lysate(22.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |