No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,ELISA |
Brand: | Abnova |
Reference: | H00011344-M01 |
Product name: | PTK9L monoclonal antibody (M01), clone 2B5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PTK9L. |
Clone: | 2B5 |
Isotype: | IgG1 Kappa |
Gene id: | 11344 |
Gene name: | TWF2 |
Gene alias: | A6RP|A6r|MSTP011|PTK9L |
Gene description: | twinfilin, actin-binding protein, homolog 2 (Drosophila) |
Genbank accession: | BC000327 |
Immunogen: | PTK9L (AAH00327, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FAGYQKHLSSCAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAFPLQPEAQRALQQLKQKMVNYIQMKLDLERETIELVHTEPTDVAQLPSRVP |
Protein accession: | AAH00327 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | PTK9L monoclonal antibody (M01), clone 2B5. Western Blot analysis of TWF2 expression in human liver. |
Applications: | WB-Ti,ELISA |
Shipping condition: | Dry Ice |