No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00011337-M05 |
Product name: | GABARAP monoclonal antibody (M05), clone 4E12 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant GABARAP. |
Clone: | 4E12 |
Isotype: | IgG2b Kappa |
Gene id: | 11337 |
Gene name: | GABARAP |
Gene alias: | FLJ25768|MGC120154|MGC120155|MM46 |
Gene description: | GABA(A) receptor-associated protein |
Genbank accession: | NM_007278.1 |
Immunogen: | GABARAP (NP_009209.1, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
Protein accession: | NP_009209.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |