No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00011336-M01 |
Product name: | EXOC3 monoclonal antibody (M01), clone 4A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EXOC3. |
Clone: | 4A7 |
Isotype: | IgG2b Kappa |
Gene id: | 11336 |
Gene name: | EXOC3 |
Gene alias: | SEC6|SEC6L1|Sec6p |
Gene description: | exocyst complex component 3 |
Genbank accession: | NM_007277 |
Immunogen: | EXOC3 (NP_009208, 646 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SGFGEDVDGYCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLAVRGDASRDMKQTIMETLEQGPAQASPSYVPLFKDIVVPSLNVAKLLK |
Protein accession: | NP_009208 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of EXOC3 expression in transfected 293T cell line by EXOC3 monoclonal antibody (M01), clone 4A7. Lane 1: EXOC3 transfected lysate(86.845 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | West nile virus and Dengue virus capsid protein negates the antiviral activity of human Sec3 protein Through The Proteasome Pathway.Raghavan B, Ng ML Cell Microbiol. 2013 Mar 22. doi: 10.1111/cmi.12143. |