Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CBX3 monoclonal antibody (M01), clone 1G12-1D9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about CBX3 monoclonal antibody (M01), clone 1G12-1D9
| Brand: | Abnova |
| Reference: | H00011335-M01 |
| Product name: | CBX3 monoclonal antibody (M01), clone 1G12-1D9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CBX3. |
| Clone: | 1G12-1D9 |
| Isotype: | IgG2a kappa |
| Gene id: | 11335 |
| Gene name: | CBX3 |
| Gene alias: | HECH|HP1-GAMMA|HP1Hs-gamma |
| Gene description: | chromobox homolog 3 (HP1 gamma homolog, Drosophila) |
| Genbank accession: | BC000954 |
| Immunogen: | CBX3 (AAH00954, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMLLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ |
| Protein accession: | AAH00954 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.87 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to CBX3 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | DNA Topoisomerase III Alpha Regulates p53-Mediated Tumor Suppression.Hsieh MY, Fan JR, Chang HW, Chen HC, Shen TL, Teng SC, Yeh YH, Li TK Clin Cancer Res. 2014 Mar 15;20(6):1489-501. doi: 10.1158/1078-0432.CCR-13-1997. Epub 2014 Feb 13. |