No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00011335-M01 |
Product name: | CBX3 monoclonal antibody (M01), clone 1G12-1D9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CBX3. |
Clone: | 1G12-1D9 |
Isotype: | IgG2a kappa |
Gene id: | 11335 |
Gene name: | CBX3 |
Gene alias: | HECH|HP1-GAMMA|HP1Hs-gamma |
Gene description: | chromobox homolog 3 (HP1 gamma homolog, Drosophila) |
Genbank accession: | BC000954 |
Immunogen: | CBX3 (AAH00954, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMLLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ |
Protein accession: | AAH00954 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (45.87 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to CBX3 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | DNA Topoisomerase III Alpha Regulates p53-Mediated Tumor Suppression.Hsieh MY, Fan JR, Chang HW, Chen HC, Shen TL, Teng SC, Yeh YH, Li TK Clin Cancer Res. 2014 Mar 15;20(6):1489-501. doi: 10.1158/1078-0432.CCR-13-1997. Epub 2014 Feb 13. |