| Brand: | Abnova |
| Reference: | H00011331-M02 |
| Product name: | PHB2 monoclonal antibody (M02), clone 2D3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PHB2. |
| Clone: | 2D3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11331 |
| Gene name: | PHB2 |
| Gene alias: | BAP|BCAP37|Bap37|MGC117268|PNAS-141|REA|p22 |
| Gene description: | prohibitin 2 |
| Genbank accession: | BC014766 |
| Immunogen: | PHB2 (AAH14766, 37 a.a. ~ 299 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK |
| Protein accession: | AAH14766 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PHB2 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |