Cart 11 Product Products 4 231,84 € (empty)
No products
To be determined Shipping
4 231,84 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 11 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 231,84 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 231,84 €
Data sheet of STK38 monoclonal antibody (M11), clone 2F6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about STK38 monoclonal antibody (M11), clone 2F6
| Brand: | Abnova |
| Reference: | H00011329-M11 |
| Product name: | STK38 monoclonal antibody (M11), clone 2F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STK38. |
| Clone: | 2F6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 11329 |
| Gene name: | STK38 |
| Gene alias: | NDR|NDR1 |
| Gene description: | serine/threonine kinase 38 |
| Genbank accession: | BC012085 |
| Immunogen: | STK38 (AAH12085, 365 a.a. ~ 465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK |
| Protein accession: | AAH12085 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human colon. [antibody concentration 2 ug/ml] |
| Applications: | WB-Ce,WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Serine-Threonine Kinase 38 regulates CDC25A stability and the DNA damage-induced G2/M checkpoint.Fukasawa T, Enomoto A, Miyagawa K. Cell Signal. 2015 Aug;27(8):1569-75. |