| Brand: | Abnova |
| Reference: | H00011329-M04 |
| Product name: | STK38 monoclonal antibody (M04), clone 2F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STK38. |
| Clone: | 2F3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11329 |
| Gene name: | STK38 |
| Gene alias: | NDR|NDR1 |
| Gene description: | serine/threonine kinase 38 |
| Genbank accession: | BC012085 |
| Immunogen: | STK38 (AAH12085, 365 a.a. ~ 465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK |
| Protein accession: | AAH12085 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | STK38 monoclonal antibody (M04), clone 2F3 Western Blot analysis of STK38 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Regulation of NDR1 activity by PLK1 ensures proper spindle orientation in mitosis.Yan M, Chu L, Qin B, Wang Z, Liu X, Jin C, Zhang G, Gomez M, Hergovich A, Chen Z, He P, Gao X, Yao X. Sci Rep. 2015 Jun 9;5:10449. |