No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00011321-M01 |
Product name: | XAB1 monoclonal antibody (M01), clone 3E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant XAB1. |
Clone: | 3E1 |
Isotype: | IgG1 Kappa |
Gene id: | 11321 |
Gene name: | GPN1 |
Gene alias: | ATPBD1A|MBDIN|NTPBP|XAB1 |
Gene description: | GPN-loop GTPase 1 |
Genbank accession: | BC007451 |
Immunogen: | XAB1 (AAH07451, 9 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ELQASGGPRHPVCLLVLGMAGSGKTTFVQRLTGHLHAQGTPPYVINLDPAVHEVPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNMSKY |
Protein accession: | AAH07451 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to XAB1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |