Cart 21 Product Products 6 585,31 € (empty)
No products
To be determined Shipping
6 585,31 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 21 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 585,31 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 585,31 €
Data sheet of MGAT4A monoclonal antibody (M01), clone 8C5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about MGAT4A monoclonal antibody (M01), clone 8C5
| Brand: | Abnova |
| Reference: | H00011320-M01 |
| Product name: | MGAT4A monoclonal antibody (M01), clone 8C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MGAT4A. |
| Clone: | 8C5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 11320 |
| Gene name: | MGAT4A |
| Gene alias: | GNT-IV|GNT-IVA |
| Gene description: | mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme A |
| Genbank accession: | NM_012214 |
| Immunogen: | MGAT4A (NP_036346, 436 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKATN |
| Protein accession: | NP_036346 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MGAT4A monoclonal antibody (M01), clone 8C5. Western Blot analysis of MGAT4A expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |