Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 850,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 850,00 €
Data sheet of COPE purified MaxPab mouse polyclonal antibody (B03P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about COPE purified MaxPab mouse polyclonal antibody (B03P)
| Brand: | Abnova |
| Reference: | H00011316-B03P |
| Product name: | COPE purified MaxPab mouse polyclonal antibody (B03P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human COPE protein. |
| Gene id: | 11316 |
| Gene name: | COPE |
| Gene alias: | FLJ13241|epsilon-COP |
| Gene description: | coatomer protein complex, subunit epsilon |
| Genbank accession: | NM_007263.3 |
| Immunogen: | COPE (NP_009194.2, 1 a.a. ~ 308 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA |
| Protein accession: | NP_009194.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of COPE expression in transfected 293T cell line (H00011316-T01) by COPE MaxPab polyclonal antibody. Lane 1: COPE transfected lysate(33.88 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |