| Brand: | Abnova |
| Reference: | H00011316-A01 |
| Product name: | COPE polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant COPE. |
| Gene id: | 11316 |
| Gene name: | COPE |
| Gene alias: | FLJ13241|epsilon-COP |
| Gene description: | coatomer protein complex, subunit epsilon |
| Genbank accession: | NM_007263 |
| Immunogen: | COPE (NP_009194, 211 a.a. ~ 308 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA |
| Protein accession: | NP_009194 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | COPE polyclonal antibody (A01), Lot # 060116JC01 Western Blot analysis of COPE expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Depletion of {beta}-COP reveals a role for COP-I in compartmentalization of secretory compartments and in biosynthetic transport of Caveolin-1.Styers ML, O'Connor AK, Grabski R, Cormet-Boyaka E, Sztul E Phd. Am J Physiol Cell Physiol. 2008 Jun;294(6):C1485-98. Epub 2008 Apr 2. |