Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PARK7 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about PARK7 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00011315-A01 |
| Product name: | PARK7 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PARK7. |
| Gene id: | 11315 |
| Gene name: | PARK7 |
| Gene alias: | DJ-1|DJ1|FLJ27376|FLJ34360|FLJ92274 |
| Gene description: | Parkinson disease (autosomal recessive, early onset) 7 |
| Genbank accession: | BC008188 |
| Immunogen: | PARK7 (AAH08188, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKG |
| Protein accession: | AAH08188 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PARK7 polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of PARK7 expression in Y-79 ( Cat # L042V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A simple cell based assay to measure Parkin activity.Morrison E, Thompson J, Williamson SJ, Cheetham ME, Robinson PA. J Neurochem. 2010 Nov 19. doi: 10.1111/j.1471-4159.2010.07113.x. [Epub ahead of print] |