| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00011313-M01 |
| Product name: | LYPLA2 monoclonal antibody (M01), clone 3H5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LYPLA2. |
| Clone: | 3H5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 11313 |
| Gene name: | LYPLA2 |
| Gene alias: | APT-2|DJ886K2.4 |
| Gene description: | lysophospholipase II |
| Genbank accession: | NM_007260 |
| Immunogen: | LYPLA2 (NP_009191, 144 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV |
| Protein accession: | NP_009191 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of LYPLA2 expression in transfected 293T cell line by LYPLA2 monoclonal antibody (M01), clone 3H5. Lane 1: LYPLA2 transfected lysate (Predicted MW: 24.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |