| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00011313-B01P |
| Product name: | LYPLA2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human LYPLA2 protein. |
| Gene id: | 11313 |
| Gene name: | LYPLA2 |
| Gene alias: | APT-2|DJ886K2.4 |
| Gene description: | lysophospholipase II |
| Genbank accession: | NM_007260.2 |
| Immunogen: | LYPLA2 (NP_009191.1, 1 a.a. ~ 231 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV |
| Protein accession: | NP_009191.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of LYPLA2 expression in transfected 293T cell line (H00011313-T01) by LYPLA2 MaxPab polyclonal antibody. Lane 1: LYPLA2 transfected lysate(25.41 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | The Endocannabinoid Metabolite Prostaglandin E2 (PGE2)-Glycerol Inhibits Human Neutrophil Functions: Involvement of Its Hydrolysis into PGE2 and EP Receptors.Turcotte C, Zarini S, Jean S, Martin C, Murphy RC, Marsolais D, Laviolette M, Blanchet MR, Flamand N. J Immunol. 2017 Apr 15;198(8):3255-3263. doi: 10.4049/jimmunol.1601767. Epub 2017 Mar 3. |