Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MGAT4B monoclonal antibody (M01), clone 1F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IF,ELISA |
More info about MGAT4B monoclonal antibody (M01), clone 1F4
| Brand: | Abnova |
| Reference: | H00011282-M01 |
| Product name: | MGAT4B monoclonal antibody (M01), clone 1F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MGAT4B. |
| Clone: | 1F4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 11282 |
| Gene name: | MGAT4B |
| Gene alias: | GNT-IV|GNT-IVB |
| Gene description: | mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme B |
| Genbank accession: | NM_014275 |
| Immunogen: | MGAT4B (NP_055090, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AEVSTSLKTYQHFTLEKAYLREDFFWAFTPAAGDFIRFRFFQPLRLERFFFRSGNIEHPEDKLFNTSVEVLPFDNPQSDKEALQEGRTATLRYPRSPDGY |
| Protein accession: | NP_055090 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MGAT4B monoclonal antibody (M01), clone 1F4. Western Blot analysis of MGAT4B expression in human pancreas. |
| Applications: | WB-Ti,IF,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | In Situ Proximity Ligation Assay (PLA) Analysis of Protein Complexes Formed Between Golgi-Resident, Glycosylation-Related Transporters and Transferases in Adherent Mammalian Cell Cultures.Maszczak-Seneczko D, Sosicka P, Olczak T, Olczak M. Methods Mol Biol. 2016 Sep 6;1496:133-43. |