| Brand: | Abnova |
| Reference: | H00011281-M08 |
| Product name: | POU6F2 monoclonal antibody (M08), clone 8F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant POU6F2. |
| Clone: | 8F9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11281 |
| Gene name: | POU6F2 |
| Gene alias: | RPF-1|WT5|WTSL |
| Gene description: | POU class 6 homeobox 2 |
| Genbank accession: | NM_007252 |
| Immunogen: | POU6F2 (NP_009183, 2 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQP |
| Protein accession: | NP_009183 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.2 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged POU6F2 is approximately 10ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |