| Brand: | Abnova |
| Reference: | H00011280-M04 |
| Product name: | SCN11A monoclonal antibody (M04), clone 6E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SCN11A. |
| Clone: | 6E1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11280 |
| Gene name: | SCN11A |
| Gene alias: | NAV1.9|NaN|SCN12A|SNS-2 |
| Gene description: | sodium channel, voltage-gated, type XI, alpha subunit |
| Genbank accession: | NM_014139 |
| Immunogen: | SCN11A (NP_054858, 1726 a.a. ~ 1791 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD |
| Protein accession: | NP_054858 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SCN11A is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |