KLF8 purified MaxPab rabbit polyclonal antibody (D01P) View larger

KLF8 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLF8 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about KLF8 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00011279-D01P
Product name: KLF8 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human KLF8 protein.
Gene id: 11279
Gene name: KLF8
Gene alias: BKLF3|DKFZp686O08126|DXS741|MGC138314|ZNF741
Gene description: Kruppel-like factor 8
Genbank accession: NM_007250.3
Immunogen: KLF8 (NP_009181.2, 1 a.a. ~ 359 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTVLTPGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAGCSKVYTKSSHLKAHRRIHTGEKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCTDCNRSFSRSDHLSLHRRRHDTM
Protein accession: NP_009181.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00011279-D01P-2-A2-1.jpg
Application image note: KLF8 MaxPab rabbit polyclonal antibody. Western Blot analysis of KLF8 expression in human colon.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KLF8 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart