| Brand: | Abnova |
| Reference: | H00011279-D01P |
| Product name: | KLF8 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human KLF8 protein. |
| Gene id: | 11279 |
| Gene name: | KLF8 |
| Gene alias: | BKLF3|DKFZp686O08126|DXS741|MGC138314|ZNF741 |
| Gene description: | Kruppel-like factor 8 |
| Genbank accession: | NM_007250.3 |
| Immunogen: | KLF8 (NP_009181.2, 1 a.a. ~ 359 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTVLTPGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAGCSKVYTKSSHLKAHRRIHTGEKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCTDCNRSFSRSDHLSLHRRRHDTM |
| Protein accession: | NP_009181.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | KLF8 MaxPab rabbit polyclonal antibody. Western Blot analysis of KLF8 expression in human colon. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |