Brand: | Abnova |
Reference: | H00011277-A01 |
Product name: | TREX1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TREX1. |
Gene id: | 11277 |
Gene name: | TREX1 |
Gene alias: | AGS1|AGS5|CRV|DKFZp434J0310|DRN3|HERNS |
Gene description: | three prime repair exonuclease 1 |
Genbank accession: | NM_016381 |
Immunogen: | TREX1 (NP_057465, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MGPGARRQGRIVQGRPEMCFCPPPTPLPPLRILTLGTHTPTPCSSPGSAAGTYPTMGSQALPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALE |
Protein accession: | NP_057465 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |