| Brand: | Abnova |
| Reference: | H00011277-A01 |
| Product name: | TREX1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TREX1. |
| Gene id: | 11277 |
| Gene name: | TREX1 |
| Gene alias: | AGS1|AGS5|CRV|DKFZp434J0310|DRN3|HERNS |
| Gene description: | three prime repair exonuclease 1 |
| Genbank accession: | NM_016381 |
| Immunogen: | TREX1 (NP_057465, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MGPGARRQGRIVQGRPEMCFCPPPTPLPPLRILTLGTHTPTPCSSPGSAAGTYPTMGSQALPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALE |
| Protein accession: | NP_057465 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |