| Brand: | Abnova |
| Reference: | H00011275-M01 |
| Product name: | KLHL2 monoclonal antibody (M01), clone 3G3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KLHL2. |
| Clone: | 3G3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11275 |
| Gene name: | KLHL2 |
| Gene alias: | ABP-KELCH|MAV|MAYVEN |
| Gene description: | kelch-like 2, Mayven (Drosophila) |
| Genbank accession: | NM_007246 |
| Immunogen: | KLHL2 (NP_009177.2, 1 a.a. ~ 66 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | METPPLPPACTKQGHQKPLDSKDDNTEKHCPVTVNPWHMKKAFKVMNELRSQNLLCDVTIVAEDME |
| Protein accession: | NP_009177.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged KLHL2 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |