Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SP140 monoclonal antibody (M07), clone 3F9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA |
More info about SP140 monoclonal antibody (M07), clone 3F9
| Brand: | Abnova |
| Reference: | H00011262-M07 |
| Product name: | SP140 monoclonal antibody (M07), clone 3F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SP140. |
| Clone: | 3F9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11262 |
| Gene name: | SP140 |
| Gene alias: | LYSP100|LYSP100-A|LYSP100-B|MGC126440 |
| Gene description: | SP140 nuclear body protein |
| Genbank accession: | NM_007237 |
| Immunogen: | SP140 (NP_009168.3, 504 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GHGWSRMRMRRQKNSQQNDNSKADGQVVSSEKKANVNLKDLSKIRGRKRGKPGTRFTQSDRAAQKRVRSRASRKHKDETVDFKAPLLPVTCGGVKGILHKKKLQQGILV |
| Protein accession: | NP_009168.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SP140 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |