DCTN3 MaxPab mouse polyclonal antibody (B01) View larger

DCTN3 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DCTN3 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about DCTN3 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00011258-B01
Product name: DCTN3 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human DCTN3 protein.
Gene id: 11258
Gene name: DCTN3
Gene alias: DCTN-22|DCTN22|MGC111190
Gene description: dynactin 3 (p22)
Genbank accession: NM_024348
Immunogen: DCTN3 (NP_077324, 1 a.a. ~ 176 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH
Protein accession: NP_077324
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011258-B01-13-15-1.jpg
Application image note: Western Blot analysis of DCTN3 expression in transfected 293T cell line (H00011258-T01) by DCTN3 MaxPab polyclonal antibody.

Lane 1: DCTN3 transfected lysate(19.36 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DCTN3 MaxPab mouse polyclonal antibody (B01) now

Add to cart