Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RNF139 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about RNF139 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00011236-A01 |
| Product name: | RNF139 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant RNF139. |
| Gene id: | 11236 |
| Gene name: | RNF139 |
| Gene alias: | HRCA1|MGC31961|RCA1|TRC8 |
| Gene description: | ring finger protein 139 |
| Genbank accession: | NM_007218 |
| Immunogen: | RNF139 (NP_009149, 565 a.a. ~ 664 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | HYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD |
| Protein accession: | NP_009149 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The Sterol-sensing Endoplasmic Reticulum (ER) Membrane Protein TRC8 Hampers ER to Golgi Transport of Sterol Regulatory Element-binding Protein-2 (SREBP-2)/SREBP Cleavage-activated Protein and Reduces SREBP-2 Cleavage.Irisawa M, Inoue J, Ozawa N, Mori K, Sato R. J Biol Chem. 2009 Oct 16;284(42):28995-9004. Epub 2009 Aug 25. |