| Brand: | Abnova |
| Reference: | H00011231-M04 |
| Product name: | SEC63 monoclonal antibody (M04), clone 1A8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SEC63. |
| Clone: | 1A8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11231 |
| Gene name: | SEC63 |
| Gene alias: | ERdj2|PRO2507|SEC63L |
| Gene description: | SEC63 homolog (S. cerevisiae) |
| Genbank accession: | NM_007214 |
| Immunogen: | SEC63 (NP_009145.1, 631 a.a. ~ 728 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KSKITHPVYSLYFPEEKQEWWWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAKPVPENHPQ |
| Protein accession: | NP_009145.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SEC63 is 1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |