Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 374,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 374,00 €
Data sheet of GALNT6 monoclonal antibody (M01), clone 4C10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about GALNT6 monoclonal antibody (M01), clone 4C10
| Brand: | Abnova |
| Reference: | H00011226-M01 |
| Product name: | GALNT6 monoclonal antibody (M01), clone 4C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GALNT6. |
| Clone: | 4C10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 11226 |
| Gene name: | GALNT6 |
| Gene alias: | GALNAC-T6|GalNAcT6 |
| Gene description: | UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6) |
| Genbank accession: | NM_007210 |
| Immunogen: | GALNT6 (NP_009141, 523 a.a. ~ 622 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV |
| Protein accession: | NP_009141 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GALNT6 monoclonal antibody (M01), clone 4C10 Western Blot analysis of GALNT6 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |