GALNT6 polyclonal antibody (A01) View larger

GALNT6 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GALNT6 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about GALNT6 polyclonal antibody (A01)

Brand: Abnova
Reference: H00011226-A01
Product name: GALNT6 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GALNT6.
Gene id: 11226
Gene name: GALNT6
Gene alias: GALNAC-T6|GalNAcT6
Gene description: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6)
Genbank accession: NM_007210
Immunogen: GALNT6 (NP_009141, 523 a.a. ~ 622 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: IMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV
Protein accession: NP_009141
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011226-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GALNT6 polyclonal antibody (A01) now

Add to cart