Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DUSP10 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about DUSP10 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00011221-A01 |
| Product name: | DUSP10 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant DUSP10. |
| Gene id: | 11221 |
| Gene name: | DUSP10 |
| Gene alias: | MKP-5|MKP5 |
| Gene description: | dual specificity phosphatase 10 |
| Genbank accession: | BC020608 |
| Immunogen: | DUSP10 (AAH20608, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVETVV |
| Protein accession: | AAH20608 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.51 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DUSP10 polyclonal antibody (A01), Lot # 050928JC01 Western Blot analysis of DUSP10 expression in 293 ( Cat # L026V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of the MEK1(F129L) Activating Mutation as a Potential Mechanism of Acquired Resistance to MEK Inhibition in Human Cancers Carrying the B-RafV600E Mutation.Wang H, Daouti S, Li WH, Wen Y, Rizzo C, Higgins B, Packman K, Rosen N, Boylan JF, Heimbrook D, Niu H. Cancer Res. 2011 Aug 15;71(16):5535-45. Epub 2011 Jun 24. |