Cart 17 Product Products 6 151,52 € (empty)
No products
To be determined Shipping
6 151,52 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 17 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 151,52 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 151,52 €
Data sheet of AKAP13 monoclonal antibody (M01), clone 5B7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about AKAP13 monoclonal antibody (M01), clone 5B7
| Brand: | Abnova |
| Reference: | H00011214-M01 |
| Product name: | AKAP13 monoclonal antibody (M01), clone 5B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AKAP13. |
| Clone: | 5B7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11214 |
| Gene name: | AKAP13 |
| Gene alias: | AKAP-Lbc|ARHGEF13|BRX|FLJ11952|FLJ43341|HA-3|Ht31|LBC|PROTO-LB|PROTO-LBC|c-lbc |
| Gene description: | A kinase (PRKA) anchor protein 13 |
| Genbank accession: | NM_006738 |
| Immunogen: | AKAP13 (NP_006729, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQ |
| Protein accession: | NP_006729 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to AKAP13 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The mRNA and protein expression of A-kinase anchor proteins 13 in human colorectal cancer.Hu JK, Wang L, Li Y, Yang K, Zhang P, Chen XZ, Wang R, Zhou ZG. Clin Exp Med. 2009 Sep 25. [Epub ahead of print] |