No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00011213-M02 |
Product name: | IRAK3 monoclonal antibody (M02), clone 1F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IRAK3. |
Clone: | 1F6 |
Isotype: | IgG1 Kappa |
Gene id: | 11213 |
Gene name: | IRAK3 |
Gene alias: | ASRT5|FLJ13601|IRAK-M|IRAKM |
Gene description: | interleukin-1 receptor-associated kinase 3 |
Genbank accession: | BC057800 |
Immunogen: | IRAK3 (AAH57800, 497 a.a. ~ 596 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCEESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE |
Protein accession: | AAH57800 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western blot analysis of IRAK3 over-expressed 293 cell line, cotransfected with IRAK3 Validated Chimera RNAi ( Cat # H00011213-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with IRAK3 monoclonal antibody (M02) clone 1F6 (Cat # H00011213-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |