Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 565,72 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 565,72 €
Data sheet of POLI monoclonal antibody (M01), clone 8G9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about POLI monoclonal antibody (M01), clone 8G9
| Brand: | Abnova |
| Reference: | H00011201-M01 |
| Product name: | POLI monoclonal antibody (M01), clone 8G9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant POLI. |
| Clone: | 8G9 |
| Isotype: | IgG3 Kappa |
| Gene id: | 11201 |
| Gene name: | POLI |
| Gene alias: | RAD30B|RAD3OB |
| Gene description: | polymerase (DNA directed) iota |
| Genbank accession: | BC032662 |
| Immunogen: | POLI (AAH32662, 616 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PQGFHFTNSNPAVSAFHSFPNLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDEKITFPSDIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK |
| Protein accession: | AAH32662 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged POLI is approximately 0.1ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Both High-fidelity Replicative and Low-fidelity Y-family Polymerases are Involved in DNA Rereplication.Sekimoto T, Oda T, Kurashima K, Hanaoka F, Yamashita T Mol Cell Biol. 2014 Dec 8. pii: MCB.01153-14. |