| Reference: | H00011198-M02 |
| Product name: | SUPT16H monoclonal antibody (M02), clone 2D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SUPT16H. |
| Clone: | 2D1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11198 |
| Gene name: | SUPT16H |
| Gene alias: | CDC68|FACT|FACTP140|FLJ10857|FLJ14010|FLJ34357|SPT16/CDC68 |
| Gene description: | suppressor of Ty 16 homolog (S. cerevisiae) |
| Genbank accession: | NM_007192 |
| Immunogen: | SUPT16H (NP_009123, 608 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE |
| Protein accession: | NP_009123 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |