No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00011198-M01 |
Product name: | SUPT16H monoclonal antibody (M01), clone 1D12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SUPT16H. |
Clone: | 1D12 |
Isotype: | IgG2a Kappa |
Gene id: | 11198 |
Gene name: | SUPT16H |
Gene alias: | CDC68|FACT|FACTP140|FLJ10857|FLJ14010|FLJ34357|SPT16/CDC68 |
Gene description: | suppressor of Ty 16 homolog (S. cerevisiae) |
Genbank accession: | NM_007192 |
Immunogen: | SUPT16H (NP_009123, 608 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE |
Protein accession: | NP_009123 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | SUPT16H monoclonal antibody (M01), clone 1D12 Western Blot analysis of SUPT16H expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |